Welder - Contractor position

Graco.wd5.graco Careers

Apply to this job
Kamas, Utah, US Until 8/22/2026 H-1B sponsor history First posted April 10, 2025 Last posted April 10, 2025
Job description

Graco manufactures and markets premium equipment to move, measure, control, dispense and spray a wide variety of fluid and powder materials. What does that mean? Well, we pump peanut butter into your jar, and the oil in your car. We glue the soles of your shoes, the glass in your windows and the screen on your phone. We spray the finish on your vehicle, coatings on your pills, the paint on your house and texture on your walls. Graco is part of your daily life. 

Where You’ll Work – White Knight Fluid Handling Inc., a subsidiary of Graco, Inc.

White Knight was established in 1995 and has consistently developed and manufactured high-quality products. We are a leading supplier of pumps and fluid transfer technology to the semiconductor, Solar Cells, LEDs, flat-panel displays, electronic and industrial markets.

Ready to join us?

JOB SUMMARY
This position is on the company’s Step Program, which includes rate increases every six months and clear path to achieve career advancement.  We’re looking for reliable, detail-oriented, hard-working, team player, career-minded individuals to help build our great team.

ESSENTIAL DUTIES

  • Weld plastic parts, creating full sealing welds while meeting production quotas
  • Maintain a clean, safe work area.
  • Perform daily maintenance of machines as required and keep supervisor informed of necessary maintenance beyond operator ability
  • Must read and understand layouts, job packets and blueprints for the parts being welded (includes Geometric Tolerancing)
  • Monitor inventory levels and ensure steps are taken to avoid lack of inventory
  • Measure parts during production to ensure parts match blueprints. This may involve the use of comparator, calipers, gages and related test instruments
  • Perform necessary side operations as required (i.e., deburring, PFA tube bending).
  • Work as a team member to aid all shifts and support personnel to operate to departmental standards including quality and productivity goals
  • Other duties as assigned.

POSITION REQUIREMENTS
Essential Qualifications:
Education/Certifications

  • High School diploma, or equivalent
  • Plastic Welding experience is preferred.


Note: A completed promotional checklist is required to promote to the next level along with required time in grade.

Skills/Abilities/Competencies

  • Ability to perform a sequence of operations under minimum supervision and consistently maintain the performance levels set for quality and quantity
  • Understanding of standard safety rules and regulations to prevent unsafe set-ups, operations, or acts which might cause injury to self, others, or environment
  • Ability to work through daily operational activities
  • Good interpersonal, written and oral communication skills
  • Ability to plan effectively and execute the plans
  • Strong mechanical aptitude
  • Strong problem solving and troubleshooting skills

Physical Requirements

  • Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions.
  • In terms of an 8-hour workday, "occasionally" means 1 to 33%, "frequently" means 34 to 66% of the time, and "continuous" means 67 to 100% of the time.
  • In an 8-hr workday, must be able to stand 4 hrs., and walk 4 hrs.
  • Position requires frequent bending and stooping, occasional use of fixed or portable stairs, crouching and kneeling and reaching above the shoulder
  • Must occasionally lift and load up to 45 lbs. or greater
  • Requires frequent repetitive elbow movements and simple grasping with both hands and occasional firm grasping and fine manipulation with both hands: (lifting, dexterity, coordination, mobility, etc.).

$20-$27 per hour, depending on experience.

At Graco, you truly make a difference. Your unique talents contribute to our organizational growth and future. Not only do you make a difference, but Graco’s culture empowers employees to create their own career path. Whether you choose to advance within your current department or explore new opportunities in different divisions, you have the ability to build your future. Our managers are here to provide support and guidance as you continue to grow within your career.

Graco has excellent opportunities available to individuals who want to be part of a fast-moving, growing company that is committed to quality, innovation and solving fluid handling problems for our customers. Graco is proud to be named a Best Place to Work by Fortune Magazine in 2016, 2018, 2019, 2021 & 2022. Graco offers attractive compensation, benefits and career development opportunities. Graco’s comprehensive benefits include medical, dental, stock purchase plan, 401(k), tuition reimbursement and more.

Our company uses E-Verify to confirm the employment and eligibility of all newly hired employees. To learn more about E-Verify, including your rights and responsibilities, please visit http://www.e-verify.gov/.

The base pay range for this position is listed below, exclusive of fringe benefits or other compensation.  If you are hired, your final base hourly rate will be determined based on factors such as geographic location, skills, competencies, education, and/or experience.  In addition to those factors, we will also consider internal equity of our current employees.  Please keep in mind that the range provided is the full base salary range for the role.  Hiring at or near the maximum of the range would not be typical to allow for future and continued salary growth.

$24.10 - $25.95
About this role

Summary

Weld plastic parts, maintain equipment, and ensure production quality.

Job title

Welder - Contractor position

Experience level

entry level

Industry

manufacturing

Location requirements

Kamas, Utah; no remote work allowed

Salary

$20-$27 per hour

Visa sponsorship

H-1B sponsor history

Management role

No

Skills & keywords

Required skills

high school diplomaplastic weldingcommunicationmechanical aptitudeproblem solving

Preferred skills

None specified

Specializations

weldingplasticmechanicalsafety
Locations

Structured locations inferred from the posting.

Kamas, UT 84036, USA

On-site City
Related searches