Web Developer

LEIDOS, INC.

Apply to this job
Hampton, VA Until 8/23/2026 6+ years exp H-1B sponsor history First posted June 24, 2026 Last posted June 24, 2026
Job description

Leidos is seeking a junior Web Developer that can code in Java & Angular.

Primary Responsibilities:

  • The Web Developer will join an existing team of Web Developers to perform Operations and Maintenance (O&M) and development activities for websites and applications developed by the customer. 

  • This includes assessments and consultations on the design of Java web tools, O&M of existing applications, server management, and development of new applications. 

  • Applications reside in physical environments and the customer's cloud environment. 

  • The Sponsor’s GTM shall set the priorities.

  • The Web Developer shall work closely with project manager, development team, information system security manager; however, the Sponsor project manager will manage the priorities.

  • The Web Developer shall provide occasional on call duty as needed.

  • The Web Developer shall assess and validate Software requirements across the organization.

  • The Web Developer shall provide architectural design and web development support to meet web application requirements.

  • The Web Developer shall participate in software design discussions and recommend implementation of the tools, technologies and techniques.

  • The Web Developer shall redesign the existing Web, Software applications to add new features, optimize, scale or improve stability and performance.

  • The Web Developer shall create, manage, and maintain software systems in AWS.

  • The Web Developer shall provide O&M and content management support for Sponsor’s Web, software sites.

  • The Web Developer shall work within Agile project management methodologies.

Basic Qualifications:

  • Must have a TS/SCI with Poly to be considered

  • Requires a Bachelor's degree and at least 8 years of experience OR Master's and at least 6 years of relatable experience.

  • Experience developing, deploying, and maintaining software applications and systems.

  • Experience identifying and validating requirements for Software or Web sites.

  • Experience working in Cloud AWS Architecture.

  • Experience adding new features, optimizing, scaling, or improving stability and performance of applications or Web.

  • Experience using JavaScript (JS).

  • Java (e.g., Springboot, Maven, Apache), Typescript (e.g., Angular, NestJS, React, Vue), Javascript (NodeJS, Express, etc.), AWS Cloud Services (S3, RDS, SQS, Lambda, EC2, etc.), CI/CD familiarization, Linux proficiency.

  • Experience with MySQL or equivalent (Postgres, SQL), developing complex data models, optimizing queries, and using Object Relational Mapping (ORM) frameworks such as TypeORM for typescript.

Preferred Qualifications:

  • Experience with software application development.

  • Experience with Web development.

  • Experience as a programming with HTML.

  • Experience Java Spring/Spring boot.

  • Experience with WordPress.

  • Experience developing and administering Windows based applications.

  • Experience developing and administering Linux applications.

  • Experience with customer's applications at this location, to include the visitor request system and student record management systems.

  • Experience with SharePoint Administration.

  • UI/UX expertise, CSS frameworks (Material, Bootstrap, etc.)

  • Experience with caching systems such as Redis, Memcache

  • Expert proficiency with software design patterns and best practices (singleton, decorator, decoupling, domain-driven).

  • Current project scope:  Ground-up redesign and development of a full-stack web application using Angular and NestJS, along with RDS MySql, SE, EC2

  • Self-starter, works under limited guidance and well with ambiguity

  • Strong critical thinking skills, test-driven development, object-oriented solid development foundation.

#MSBA

If you're looking for comfort, keep scrolling. At Leidos, we outthink, outbuild, and outpace the status quo — because the mission demands it. We're not hiring followers. We're recruiting the ones who disrupt, provoke, and refuse to fail. Step 10 is ancient history. We're already at step 30 — and moving faster than anyone else dares.

Original Posting:

June 24, 2026

For U.S. Positions: While subject to change based on business needs, Leidos reasonably anticipates that this job requisition will remain open for at least 3 days with an anticipated close date of no earlier than 3 days after the original posting date as listed above.

Pay Range:

Pay Range $92,300.00 - $166,850.00

The Leidos pay range for this job level is a general guideline only and not a guarantee of compensation or salary. Additional factors considered in extending an offer include (but are not limited to) responsibilities of the job, education, experience, knowledge, skills, and abilities, as well as internal equity, alignment with market data, applicable bargaining agreement (if any), or other law.

About this role

Summary

Develop, maintain, and optimize web applications using Java, Angular, and AWS.

Job title

Web Developer

Experience level

8+ years or 6+ years with master's degree

Minimum experience

6+ years exp

Industry

defense and technology

Location requirements

Hampton, VA; remote work not specified

Salary

$92k–$167k

Visa sponsorship

H-1B sponsor history

Management role

No

Skills & keywords

Required skills

javaangularjavascriptawsmysqltypescriptlinux

Preferred skills

springbootwordpresssharepointcss frameworksredis

Specializations

web developmentjavaangularcloud awsjavascript
Locations

Structured locations inferred from the posting.

Hampton, VA, USA

Work arrangement unknown City