Senior Fullstack Engineer - Chartering & Inbox

Budapest hybrid Until 8/23/2026 6+ years exp First posted June 24, 2026 Last posted June 24, 2026
Job description
At Kpler, we are dedicated to helping our clients navigate complex markets with ease. By simplifying global trade information and providing valuable insights, we empower organisations to make informed decisions in commodities, energy, and maritime sectors.
 
Since our founding in 2014, we have focused on delivering top-tier intelligence through user-friendly platforms. Our team of over 850 experts from 69 countries works tirelessly to transform intricate data into actionable strategies, ensuring our clients stay ahead in a dynamic market landscape. Join us to leverage cutting-edge innovation for impactful results and experience unparalleled support on your journey to success.
 

Your future position

 
As a Senior Fullstack Engineer for the MT Inbox crew, your mission is to be an engineering leader, driving high-impact initiatives to provide reliable and scalable email client solutions to our customers. This role requires independent handling of complex technical communication with stakeholders and clients, ensuring the system's performance and reliability. You will also be responsible for mentoring and coaching junior and mid-level engineers to foster engineering excellence within the team. 

Your mission is to:

  • Design and Build End-to-End Features: Develop scalable and high-performance frontend and backend systems, working across the stack with technologies like AWS, K8S, Ruby on Rails (our legacy system), Python and Vue.js.

  • Lead Strategic Alignment and Initiatives: Drive high-impact engineering initiatives and manage technical communication with engineering managers, product managers, designers, and customers independently to ensure solutions align with critical business and reliability requirements.

  • Champion Engineering Excellence: Write robust, maintainable code and implement best practices around testing, CI/CD, performance, observability and reliability.

  • Architect Scalable Systems: Design and implement distributed systems and microservices with event-driven architecture using Kafka.

  • Maintain and Scale Tech Stack: This role offers a unique balance - you'll lead the scaling efforts of our production Rails environment to keep pace with our growth, while simultaneously architecting 'greenfield' components as we refactor toward our future-state tech stack.

  • Mentor and Coach: Serve as an engineering leader by mentoring junior and mid-level engineers on development best practices, engineering operational excellence, and complex system design.

  • Own Operations and Reliability: Take part in monitoring, incident response, production support and performance tuning across the stack.

  • Contribute to Agile Culture: Actively participate in sprint planning, retrospectives, and other Agile ceremonies to continuously improve team practices.

This could be a match if you have:

     

  • 6+ years developing production-grade applications with Ruby/Python, backend frameworks (preferably Ruby on Rails + Sidekiq and FastAPI) and frontend frameworks (preferably Vue.js) in TypeScript.

  • Strong expertise in designing, implementing, and maintaining microservices architectures.

  • Solid hands-on experience with Kafka and event-driven systems.

  • Proficiency in MySQL, Elasticsearch, and Redis.

  • Familiarity with AWS and infrastructure orchestration tools like Kubernetes and Helm.

  • Deep understanding of data structures, distributed systems, and system design principles.

  • Excellent communication and collaboration skills, technical leadership and mentoring, strong adherence to Agile methodologies, decisive and purpose-driven (we make things happen), supportive and collaborative nature (we always help each other). 
  • Experience integrating SDKs and APIs into web

  • Exposure to DevOps tooling and practices (GitHub Actions, observability, SonarQube, etc.).

  • Prior work in fast-paced, product-focused environments or the maritime/logistics domain.

We are a dynamic company dedicated to nurturing connections and innovating solutions to tackle market challenges head-on. If you thrive on customer satisfaction and turning ideas into reality, then you’ve found your ideal destination. Are you ready to embark on this exciting journey with us?
 
We make things happen
We act decisively and with purpose, going the extra mile.
 
We build
together
We foster relationships and develop creative solutions to address market challenges.
 
We are here to help
We are accessible and supportive to colleagues and clients with a friendly approach.
 
 
Our People Pledge
 
Don’t meet every single requirement? Research shows that women and people of color are less likely than others to apply if they feel like they don’t match 100% of the job requirements. Don’t let the confidence gap stand in your way, we’d love to hear from you! We understand that experience comes in many different forms and are dedicated to adding new perspectives to the team.
 
Kpler is committed to providing a fair, inclusive and diverse work-environment. We believe that different perspectives lead to better ideas, and better ideas allow us to better understand the needs and interests of our diverse, global community. We welcome people of different backgrounds, experiences, abilities and perspectives and are an equal opportunity employer.
 
 
 
By applying, I confirm that I have read and accept the Staff Privacy Notice
About this role

Summary

Design, develop, and scale email systems, mentor engineers, and ensure system reliability.

Job title

Senior Fullstack Engineer - Chartering & Inbox

Experience level

6+ years

Minimum experience

6+ years exp

Industry

maritime

Location requirements

Budapest, remote work not specified

Salary

Not specified

Management role

No

Skills & keywords

Required skills

ruby on railspythonvue.jskafkamysqlelasticsearchredisawskuberneteshelmapi integrationci/cd

Preferred skills

mentoringagiledevopsperformance tuningincident response

Specializations

fullstackmicroservicesdistributed systemskafkacloud
Locations

Structured locations inferred from the posting.

Budapest, Hungary

Hybrid City