Senior Backend Engineer

myTomorrows

Apply to this job
Amsterdam HQ remote Until 9/28/2026 4+ years exp First posted July 30, 2026 Last posted July 30, 2026
Job description

About myTomorrows 

myTomorrows is a global health tech company dedicated to breaking down barriers for patients seeking treatment options.   

We strive to enable earlier and better treatment access by bridging the gap between those searching for possible options, and the companies who develop them. We work closely with patients, healthcare professionals, trial sites, patient advocacy groups, and BioPharma – connecting key stakeholders in the drug development ecosystem.   

We’ve developed a cutting-edge AI-powered technology platform that simplifies and streamlines access to drugs in development. To support our users and clients, we have a range of industry-expert specialized teams ready to help. Our services include clinical trial patient recruitment, Expanded Access Program management and Real-World Data collection.   

With a global footprint spanning 134 countries, to date we’ve supported over 17,000 patients, 3,000 physicians and 350 sites, earning the trust of 60+ BioPharma companies. In October 2025, we closed a €25M investment with Avego Healthcare Capital to fuel our global ambitions and scale the business.  

Join us in shaping the future of treatment access - making tomorrow’s therapies accessible for people who need them today. 

The opportunity: Senior Backend Engineer

As a Senior Backend Engineer, you will be responsible for developing and maintaining the platform infrastructure that powers our products. You will work closely with our Frontend Engineers, DevOps Engineers, and other stakeholders to design and build scalable, reliable, and high-performance products.

Given that most of our team is located in the Netherlands, we only consider candidates for this position who live within commuting distance to our office in Amsterdam.

What you'll do in this role:

  • Design and implement scalable and reliable backend systems and infrastructure to support our products

  • Develop and maintain our micro-services to expose platform functionality to internal and external clients

  • Collaborate with development and quality assurance teams to ensure high availability, scalability, and security of our systems

  • Collaborate with DevOps Engineers to ensure the continuous delivery and deployment of software products

  • Work with software developers to identify and implement improvements to our platform architecture and functionality

  • Develop and maintain documentation of our systems and processes

  • Mentor and train junior members of the backend team

  • Keep up-to-date with the latest trends and technologies

What you bring to the table:

  • Proficiency in Python programming language

  • 4+ years of experience in the related field

  • Experience with relational databases such as MySQL, PostgreSQL, or Oracle

  • Experience with the cloud platforms (AWS, Azure or GCP)

  • Experience with containerization technologies such as Docker and Kubernetes

  • Excellent problem-solving skills and ability to work independently and as part of a team

  • Strong communication skills and the ability to work with stakeholders across the organization

  • Excellent English communication skills

What succes in the first six months looks like:

  • You’ve built trust with Product, Frontend, and DevOps peers and taken clear ownership of 2-3 domain APIs/services, including stewardship of their contracts and SLAs.

  • You’ve established an API-first workflow: starting from use cases, you propose and socialize OpenAPI specs, align on naming and conventions, then implement in FastAPI with Pydantic models.

  • You’ve delivered impactful API features end-to-end (design → implementation → tests → docs) that are consumed by internal and external clients without hand-holding.

  • You’ve raised API robustness: strong request/response validation, consistent error models, pagination and idempotency where appropriate, and backward-compatible versioning enforced via automated contract tests in CI (Ruff, UV, Prek).

  • You’ve improved the reliability and performance of our service by adding meaningful observability (metrics, logs, tracing) and defining SLIs/SLOs for key endpoints—reducing 5xx rates and improving p95 latency.

  • You’ve made safe database changes in MySQL with SQLAlchemy migrations, optimized critical queries, and contributed to data access patterns involving DynamoDB or Neo4j while keeping API contracts stable.

  • You’ve strengthened the security of APIs (authN/authZ boundaries, scoped tokens, least-privilege access, secrets management, rate limiting) and documented the approach.

  • You’ve written clear API documentation and examples (e.g., snippets/collections), shared knowledge with the team, and mentored junior engineers so others can build on your work.

Current tech stack:

We are fully cloud-native, leveraging AWS and adopting a Lean, API-first product development approach driven by modern cloud technologies and thoughtful design practices.

Our backend applications are built using Python, FastAPI, Pydantic, and SQLAlchemy (MySQL). On the front end, we predominantly develop with Angular. To ensure code quality and a consistent release pipeline, we employ GitHub Actions for CI/CD along with tools like Renovate, Ruff, UV, and Prek.

We containerize our applications using Docker and Docker Compose. We continue to expand our capabilities in knowledge graphs (Neo4j) and database technologies (MySQL, DynamoDB).

What we offer:

  • Impactful work that helps patients gain access to potentially lifesaving treatments. 

  • International work environment, scale-up energy and a flat organizational structure that encourages creativity and accountability. 

  • Competitive salary, annual performance bonus and an Employee Stock Option Plan. 

  • Great career development opportunities in a fast-growing company.  

  • Learning and development budget alongside internal knowledge sharing sessions. 

  • Attractive pension plan, full premium covered by myTomorrows. 

  • Hybrid working model. 

  • Policies to support working parents. 

  • Healthy lunch at the thriving Amsterdam office.  

  • Unlimited access to professional guidance by certified psychologists via OpenUp  

  • Enjoy monthly events hosted by our vibrant Culture Club as well as an annual ‘myTomorrowland’ company-wide celebration! 

Equal opportunities

myTomorrows is an Equal Opportunity Employer and, beyond upholding discrimination-free practices, we are committed to cultivating a workplace where difference and diversity are protected and celebrated. The best work comes from our best selves, and we go to great lengths in supporting our team members to be just that. 

About this role

Summary

Develop and maintain scalable backend systems, APIs, and infrastructure in a cloud environment.

Job title

Senior Backend Engineer

Experience level

4+ years

Minimum experience

4+ years exp

Industry

healthtech

Location requirements

Amsterdam HQ, onsite only

Salary

Not specified

Management role

No

Skills & keywords

Required skills

pythonrelational databasesawsdockerkubernetes

Preferred skills

api-firstopenapifastapipydanticsqlalchemy

Specializations

pythonfastapisqlalchemyawsdocker
Locations

Structured locations inferred from the posting.

Unknown location

On-site