Linux System Administrator

Caci.wd1.referral

Apply to this job
US FL Sarasota Until 8/21/2026 First posted March 22, 2025 Last posted March 22, 2025
Job description
Linux System Administrator

Job Category: Information Technology

Time Type: Full time

Minimum Clearance Required to Start: TS/SCI with Polygraph

Employee Type: Regular

Percentage of Travel Required: Up to 10%

Type of Travel: Continental US

* * *


The Opportunity:

CACI has an immediate opening for a Linux Systems Administrator, with a Top Secret Clearance (TS/SCI) with polygraph for our corporate development/test network and fielded systems. CACI is seeking a development Systems Administrator with Linux experience for our Sarasota (FL) location. In this position, the individual will work with emerging technologies in the space domain awareness sector. This sector is focused on ground- and space-based systems that detect, characterize, and predict threats to national and allied space systems.  You will participate in system design reviews, create and revise documentation, perform hardware and software integration/configuration, and participate in system testing and software installation.  As a Systems Administrator, you will assist with the build, test, and deployment of systems worldwide. You will also be working with the latest Enterprise IT tools to troubleshoot existing systems in the field. 

Continental US and international travel may be required up to 10% as well as periodic surge support.

Responsibilities:

  • Support critical Space Domain Awareness missions.

  • Travel to unique and exciting locations.

  • Work the entire lifecycle of the mission system from design, installation, and operations.

  • Participate in system design, software configuration, documentation, testing and troubleshooting.

  • Perform fault-isolation of ground-based satellite system hardware and software working with various stakeholders.

  • Participate in peer-review of system designs to ensure the system meets the technical requirements and conforms with established technical standards.

  • Build, configure and test various system components to reflect design documents.

  • Requires an ability to effectively communicate and work collaboratively with others in a fast-paced environment while multi-tasking.

  • Regularly completes assigned tasks that have a direct impact on project schedule or system functionality.

  • Troubleshoot issues with your assigned system as needed.


Qualifications:

  • Bachelor’s degree (or higher) in Computer Science, Computer Engineering, or related discipline from an accredited college or university with fivee years of related experience.

  • A TS/SCI with Poly or the ability to obtain a Poly is required.

  • Possess an understanding of comprehensive system administration principles, and problem-solving skills.  

  • Three years minimum Linux experience with a focus on Red Hat. 

  • Competence in MS Office suite including Visio.

  • Participate in system design, hardware and software integration/configuration, documentation, system hardening and testing and delivery that meet the functional requirements of the system.

  • Must be willing to meet all requirements to facilitate a system installation at DoD facility. Knowledge and experience in system administration processes including at least one of the following certifications:

  • A+ CE, CCNA-Security, CND, Network+ CE, SSCP, CCNA Security, CySA+, GICSP, GSEC, Security+ CE, CASP+ CE, CISA, CISSP, GCED, GCIH, CCSP Experience in installation, integration, configuration, tuning, OS patching (IAVA), and network/OS security and troubleshooting of Red Hat Linux servers.
  • Experience with virtualization environments (e.g. VMware, Red Hat Virtualization, KVM) Experience with network attached storage using NFS (e.g. NetApp)

  • Experience with installing and configuring server hardware (HP) and provisioning with Raid and iLO.


Desired:

  • Experience using network monitoring tools.

  • Excellent communication skills in technical, business, and client interactions Experience with Scripting languages (e.g. Perl, Bash)

  • Experience with DevSecOps and respective tools

  • Experience supporting ISSO and ISSEs via technical implementation (e.g. DISA STIG).

  • Experience with network switch hardware, VLANs, and basic troubleshooting (e.g. Cisco IOS)

  • Experience with any infrastructure management tools (e.g. Satellite)

  • Experience with containerization with Kubernetes and Podman background preferred 

  • Automation tools (e.g. Ansible, Puppet, Git CI)

  • Experience with Ticket tracking tools (e.g. Atlassian)

  • Experience with Integrated Product Teams

  • Polygraph

This position is contingent on funding and may not be filled immediately. However, this position is representative of positions within CACI that are consistently available. Individuals who apply may also be considered for other positions at CACI.

________________________________________________________________________________________

What You Can Expect:

 

A culture of integrity.

At CACI, we place character and innovation at the center of everything we do. As a valued team member, you’ll be part of a high-performing group dedicated to our customer’s missions and driven by a higher purpose – to ensure the safety of our nation.

 

An environment of trust.

CACI values the unique contributions that every employee brings to our company and our customers - every day. You’ll have the autonomy to take the time you need through a unique flexible time off benefit and have access to robust learning resources to make your ambitions a reality.

A focus on continuous growth.

Together, we will advance our nation's most critical missions, build on our lengthy track record of business success, and find opportunities to break new ground — in your career and in our legacy. 

 

Your potential is limitless. So is ours.

Learn more about CACI here.

________________________________________________________________________________________

Pay Range: There are a host of factors that can influence final salary including, but not limited to, geographic location, Federal Government contract labor categories and contract wage rates, relevant prior work experience, specific skills and competencies, education, and certifications. Our employees value the flexibility at CACI that allows them to balance quality work and their personal lives. We offer competitive compensation, benefits and learning and development opportunities. Our broad and competitive mix of benefits options is designed to support and protect employees and their families. At CACI, you will receive comprehensive benefits such as; healthcare, wellness, financial, retirement, family support, continuing education, and time off benefits. Learn more here.

The proposed salary range for this position is:

$71,500 - $150,200

CACI is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, pregnancy, sexual orientation, age, national origin, disability, status as a protected veteran, or any other protected characteristic.
About this role

Summary

Manage Linux systems, support space domain awareness missions, and perform system integration.

Job title

Linux System Administrator

Experience level

5+ years

Industry

information technology

Location requirements

Located in Sarasota, FL; remote work not allowed.

Salary

$71,500 - $150,200

Management role

No

Skills & keywords

Required skills

bachelor's degreets/sci with polygraphlinuxred hatms officesystem administrationa+ ceccna-securitycndnetwork+ cesscpcybersecuritygsecsecurity+ cecasp+ cecisacisspgcedgcihccspvmwarenfshp

Preferred skills

network monitoringscriptingdevsecopsnetwork switchinfrastructure managementcontainerizationautomationticket tracking

Specializations

linuxsystem administrationred hatnetworkingvirtualization
Locations

Structured locations inferred from the posting.

Sarasota, FL, USA

On-site City