Lead Software Engineer (Europe)

Lisbon (office) or Europe (remote) Until 8/21/2026 H-1B sponsor history First posted September 9, 2025 Last posted September 9, 2025
Job description

About Horizons

At Horizons, we're building the infrastructure to power borderless teams. By handling global payroll, benefits, taxes, and compliance, our technology enables businesses to hire anyone anywhere compliantly at the push of a button.

If you're interested in adding to our vision of enabling people to work in dream jobs, for every company, and from anywhere in the world, apply now!

We're committed to building a global, diverse team representing different and varied backgrounds, perspectives, and experiences. We welcome applications from everyone, regardless of gender, ethnicity, sexual orientation, religion, civil or family status, age, or disability. Being a Horizoneer means being part of a growing, international family.

We're seeking a hands-on Technical Leader who thrives in a collaborative, fast-paced, and innovation-driven environment. You’ll play a crucial role in shaping the architecture and technical excellence of our products while fostering a culture of learning and growth within the Engineering Team. 

Responsibilities:

  • Provide technical design for new features using Domain-Driven Design (DDD) methodologies.
  • Maintain and lead the technical roadmap, ensuring alignment with business goals.
  • Document technical architectures, workflows, and processes for reference and clarity.
  • Actively contribute to the codebase (up to 40% of the time) focusing on high-complexity tasks, technical enablers and Proof of Concepts (PoCs) to evaluate and implement innovative technologies.
  • Conduct code reviews to uphold high-quality software coding standards.
  • Participate to define technical priorities and set the technical direction for the Engineering team.
  • Support recruitment efforts by interviewing candidates to identify future talent.
  • Act as a Technical Lead, guiding and mentoring Software Engineers in their technical growth, encouraging learning and skill development within the team.

Requirements:

  • Minimum of 8 years in a Software Development role including 2 years as a Tech Lead or Architect.
  • At least 3 years of experience working on SaaS applications.
  • Proven experience designing and implementing service-based architectures in production environments.
  • Prior experience with Online Payment, Payroll or Invoicing domains.
  • Prior experience with integrating third party solutions into core business processes.

Preferred Skills:

  • Expertise in API design with REST, gPRC, GraphQL and API documentation with OpenAPI, Swagger.
  • Experience with various data stores, streaming and caching solutions (SQL and NoSQL databases, Redis, MQ, Kafka, ElasticSearch).
  • Extensive knowledge of cloud platforms (e.g., AWS) and their services.
  • Work experience with Python and Java.
  • Strong focus on security, scalability, and performance optimization.
  • Ability to solve complex problems with simple, effective solutions.
  • Strong collaboration and teamwork skills with a capacity for independent work.
  • High ownership mindset, always striving for improvements.
  • Excellent presentation and documentation skills.
  • Set high standards for others and for yourself.

If you're passionate about building high quality software and enjoy working in a supportive team environment, we encourage you to apply and become a valuable part of our Product and Engineering team.

 

 

What it's like working at Horizons

Our service & product. We're a technology company, not an accountancy, payroll provider, recruitment firm or similar. We build a workforce management platform that allows our customers to hire the best talent in minutes, without worrying about compliance, payroll, or HR admin.

Our amazing team and environment. Working at Horizons means you're working on something very exciting: Allowing every person on the planet to have access to equal opportunities in living a fulfilled work and personal life. We believe in hiring from within and going the extra mile to retain top talent. As the company continues to grow extremely fast, you will be given the opportunity to develop and grow alongside.

Our benefits and perks. Being a Horizoneer means that you get the benefit of:

  • A competitive salary
  • An asynchronous working environment
  • A "Remote-First" company environment (or Hybrid) - based on the nature of the job
  • The ability to work from abroad for a short period of time
  • Growth opportunities within the company
  • We provide all new joiners with the necessary hardware to ensure you have the tools you need to succeed from day one

How to apply

Please fill out the form and upload your CV in a PDF format.

If you don’t have an up-to-date CV but you are still keen to reaching out, please feel free to add a copy of your LinkedIn profile instead.

Need help? Get in touch with us at: [email protected]

 

About this role

Summary

Lead technical design, guide team, develop high-quality SaaS applications, and ensure scalable, secure solutions.

Job title

Lead Software Engineer (Europe)

Experience level

8+ years

Industry

software

Location requirements

Remote or Lisbon, Portugal, with flexible options

Salary

Not specified

Visa sponsorship

H-1B sponsor history

Management role

Yes

Skills & keywords

Required skills

software developmentservice-based architecturesaasapi designcloud platforms

Preferred skills

restgrpcgraphqlopenapiswaggersqlnosqlredismqkafkaelasticsearchawspythonjavasecurityperformancecollaborationdocumentation

Specializations

architecturesaaspaymentapi designcloud
Locations

Structured locations inferred from the posting.

Lisbon, Portugal

On-site City

Unknown location

Remote