Full Time direct Hire Opportunity for a Full Stack Developer (In person Interview)

360 IT Professionals

Apply to this job
San Francisco, CA, us on site Until 8/21/2026 First posted February 25, 2026 Last posted February 25, 2026
Job description

360 IT Professionals is a Software Development Company based in Fremont, California that offers complete technology services in Mobile development, Web development, Cloud computing and IT staffing. Merging Information Technology skills in all its services and operations, the company caters to its globally positioned clients by providing dynamic feasible IT solutions. 360 IT Professionals work along with its clients to deliver high-performance results, based exclusively on the one of a kind requirement.

Our services are vast and we produce software and web products. We specialize in Mobile development, i.e. iPhone and Android apps. We use Objective C and Swift programming languages to create native applications for iPhone, whereas we use Android Code to develop native applications for Android devices. To create applications that work on cross-platforms, we use a number of frameworks such as Titanium, PhoneGap and JQuery mobile. 

Furthermore, we build web products and offer services such as web designing, layouts, responsive designing, graphic designing, web application development using frameworks based on model view controller architecture and content management system. Our services also extend to the domain of Cloud Computing, where we provide Salesforce CRM to effectively manage one’s business and ease out all the operations by giving an easy platform. Apart from this, we also provide IT Staffing services that can help your organization to a great extent as you can hire highly skilled personnel’s through us.

We make sure that we deliver performance driven products that are optimally developed as per your organization’s needs. Take a shot at us for your IT requirements and experience a radical change.

- Senior Full stack developer with Ruby on Rails exp ( backend)

- Experience developing application on Google Cloud Platform

- Front end Development experience in React, JS, Angular)

- Mobile Application Development is a plus ( mobile platform)

- E-Commerce exp

- Someone who has experience developing merchant community/ scalable applications

· Experience with PostgreSQL, Sidekiq, and delayed jobs

· Familiarity with Git, RSpec, and Capybara

· Experience integrating external API's

· Building a RESTful API

· Building a Gem

· jQuery and Javascript

· HTML and CSS

· ElasticSearch

· Redis

· Open source contributions

· AWS architecture and Chef

Thanks and Regards,

Karan Sharma

510-254-3300 ext. 150

About this role

Summary

Develop scalable full stack applications with cloud, mobile, and API integrations.

Job title

Full Stack Developer

Experience level

senior level

Industry

software

Location requirements

In person in San Francisco, CA, no remote work allowed

Salary

Not specified

Management role

No

Skills & keywords

Required skills

ruby on railsgoogle cloud platformreactjsangularpostgresqlsidekiqdelayed jobsgitrspeccapybaraapigemjqueryjavascripthtmlcsselasticsearchredisawschef

Preferred skills

mobile developmente-commercemerchant communityscalable applicationsopen source contributions

Specializations

full stackreactruby on railscloudmobile
Locations

Structured locations inferred from the posting.

San Francisco, CA, USA

On-site City