Engineer II - Web Development

Reston,Virginia,US Until 9/12/2026 2+ years exp H-1B sponsor history First posted July 14, 2026 Last posted July 14, 2026
Job description

Verisign helps enable the security, stability, and resiliency of the internet. We are a trusted provider of internet infrastructure services for the networked world and deliver unmatched performance in domain name system (DNS) services. 

We are a mission focused, values driven company where each individual can contribute to building a stronger, more secure internet.  We offer a dynamic and flexible work environment with competitive benefits and the ability to grow your career.

Verisign is looking for a junior engineer to expand the Verisign Web Marketing Development team.

An ideal candidate should be familiar with JavaScript and have prior experience in web development, including building frontend pages and components, and managing site tooling and dependencies. We build and manage high visibility websites that are informational and educational in nature, so creating performant UX components and templates is a priority for the team. Exposure to additional languages and technologies (AWS/Cloud, Docker, Jenkins, Ansible, Bash) is advantageous. We seek a candidate with strong understanding of software engineering fundamentals, including core Computer Science concepts, as well as hands-on problem-solving experience building software systems.

The candidate will be involved in all aspects of product development including ideation, design, implementation, deployment, and issue resolution. This will usually imply cross-team collaboration with Product, Marketing, Engineering, Security and Operations teams. The candidate is expected to provide technical contributions and work collaboratively with other team members.

Product

Web Marketing operates a set of customer-facing web applications and static sites, which deliver informational content and the latest news from Verisign. This includes the primary corporate site of verisign.com, several product and campaign focused sites, and a public blog. The team is on course to unify all these sites under a common framework, toolset, and design system which allows for reuse of front-end components. Additionally, the team operates their infrastructure in the public cloud and is responsible for maintaining and improving those platforms. 

This team manages a collection of front-end components, including site templates, themes, and Web Components for interactivity, as well as a git-based content editing workflow. 

Team

The team possesses extensive technical ownership over the product. The work style of the team is closer to an internal startup where all the team members are involved in the majority of product development phases and are flexible moving between focus areas.

The team follows Agile Development methodology relying on daily Scrums with tickets prioritized in Jira. Our code is located on internal GitHub; we utilize pull request code reviews. For continuous delivery, we use Jenkins with pipelines and our product deployments are automated with Docker, Ansible, and Terraform. 

It is clearly beneficial if the candidate has experience working with some of the tools mentioned.

Skills

Required

  • Expertise in JavaScript
  • Frontend web development experience: HTML, CSS, JavaScript, TypeScript
  • Ability to optimize webpage loading and rendering
  • Working knowledge of at least one version control system: Git, SVN, etc.
  • Experience with common website toolchains and dependencies: npm, webpack/babel, prettier, postCSS, etc.
  • OS: Familiarity with UNIX-like operating systems
  • Demonstration of understanding of Secure Coding standards.
  • Excellent communication skills (verbal and written), eager to learn new technologies

Advantageous

  • Frameworks: StencilJS, Astro, Tailwind CSS
  • Frontend Testing frameworks: Jest, Enzyme, Mocha, BrowserStack, StoryBook
  • Test Automation: Unit/Integration/UI testing (Playwright, Selenium, Puppeteer) 
  • AWS Public cloud services including Cloudfront, S3 and Route53
  • Methodology: Scrum
  • Scripting: Bash, Python
  • Containerization: Docker
  • CI/CD/CM: Git, Jenkins, Gradle, Yarn
  • Deployment Automation: Ansible, Terraform
  • CDN configuration/management experience

Education and experience:

  • Bachelor’s degree in computer science or a related field with 2+ years software development experience
  • or a Master’s degree with hands-on software development work experience through demonstrable projects or internships
  • or equivalent experience

This position is based in our Reston, VA office and offers a hybrid work schedule.

The pay range is $89,900 - $121,700. 

The anticipated annual base salary range for this position is noted above, however, base pay offered may vary depending on job-related knowledge, skills, experience. Verisign offers a discretionary bonus which is based on individual and company performance, and certain roles may be eligible for discretionary stock awards.

Verisign is an equal opportunity employer. That means we recruit, hire, compensate, train, promote, transfer, and administer all terms and conditions of employment without regard to their race, color, religion, national origin, sex, sexual orientation, gender identity, age, protected veteran status, disability, or other protected categories under applicable law.

Additional Information:
Our Careers Page
Our Benefits Summary
Verisign in the Community
Our EEO Statement
Our Privacy Notice for Job Applicants/Candidates
Reasonable Accommodations

Staffing agency policy: No fees will be paid for unsolicited resumes submitted to Verisign or our employees by third parties.

About this role

Summary

Develop and optimize web frontend components, collaborate across teams, and deploy in cloud environments.

Job title

Engineer II - Web Development

Experience level

2+ years

Minimum experience

2+ years exp

Industry

internet infrastructure

Location requirements

Hybrid in Reston, VA; remote work allowed

Salary

$90k–$122k

Visa sponsorship

H-1B sponsor history

Management role

No

Skills & keywords

Required skills

javascripthtmlcsstypescriptgitnpmwebpackprettierpostCSSunix

Preferred skills

stenciljsastrotailwind cssjestenzymemochabrowserstackstorybookplaywrightseleniumpuppeteerawscloudfronts3route53bashpythondockerjenkinsgradleyarnansibleterraformcdn

Specializations

javascriptweb developmentfrontendhtmlcss
Locations

Structured locations inferred from the posting.

Reston, VA, USA

Hybrid City

Virginia, USA

Remote State