Circle Lead Engineer (CLE) - Personal Insurance

Travelers Indemnity Co

Apply to this job
CT - Hartford Until 8/23/2026 7+ years exp H-1B sponsor history First posted June 12, 2026 Last posted June 12, 2026
Job description

Who Are We?

Taking care of our customers, our communities and each other. That’s the Travelers Promise. By honoring this commitment, we have maintained our reputation as one of the best property casualty insurers in the industry for over 170 years. Join us to discover a culture that is rooted in innovation and thrives on collaboration. Imagine loving what you do and where you do it.

Job Category

Technology

Compensation Overview

The annual base salary range provided for this position is a nationwide market range and represents a broad range of salaries for this role across the country. The actual salary for this position will be determined by a number of factors, including the scope, complexity and location of the role; the skills, education, training, credentials and experience of the candidate; and other conditions of employment. As part of our comprehensive compensation and benefits program, employees are also eligible for performance-based cash incentive awards.

Salary Range

$153,700.00 - $253,700.00

Target Openings

1

What Is the Opportunity?

Travelers is seeking a Circle Lead Engineer (CLE) to join our organization as we grow and transform our Personal Insurance Technology landscape. Individual will complete expert end to end engineering tasks as well as manage and lead the development and work products of software engineers. Individual will also plan and execute at a strategic level, lead and influence resources and outcomes, lead the design, development and implementation of significantly complex, unscoped problems that extend beyond the confines of a team, and establish software engineering best practices and standards.

What Will You Do?

  • The CLE is accountable for the set of technical product solutions in the circle, ensuring they are well bounded and composable, all while growing and nurturing the circle’s engineering team’s skillsets. This includes:

  • Technical Guidance: Provide technical guidance and leadership to Team Lead Engineers though helping them understand how their team’s technical solutions fit together to accelerate the Circle’s mission.
  • Solution Architecture and Design: Collaborate with the Team Lead Engineers to define the solution architectures and design of the technical components to ensure boundaries are maintained. Partners with and defers to architecture when an architecturally significant change is needed for a design that spans teams.
  • Best Practices and Quality Assurance: Ensures teams are producing systems that meets all non-functional requirements, is well-bounded, composable, and adheres to Software Engineering best practices. Provides feedback to Team Lead Engineers to help them improve their system building skills.
  • Collaboration with Circle Leadership: Works closely with the Circle leaders to ensure the Circle’s mission, vision, and objectives and KPIs are satisfied by the systems being maintained and built by the teams. Provides oversight to ensure capabilities are properly bounded.
  • Estimation and Planning: Participate in increment planning sessions to assist with and provide oversight over the estimation of the technical effort required for implementing features, user stories and tasks. Help the teams, where necessary, break down work into smaller, actionable tasks.
  • Technical Integrations: Own technical interdependencies of systems within the Circle and ensure an adequate interaction model across teams to support these.
  • Problem Solving: Help the Team Lead Engineers overcome technical challenges and roadblocks by offering expertise, brainstorming solutions, and providing support as needed.
  • Continuous Improvement: Foster a culture of continuous improvement within the Circle, encouraging experimentation, learning, and the adoption of new technologies and practices.
  • Lead by example, mentor, and coach: Lead by example, demonstrating professionalism, integrity, and a commitment to quality in all aspects of the work. Mentor Team Lead Engineers, helping them develop their technical skills and grow as engineers and leaders. Provide coaching on topics such as soft skills, coding practices, design patterns, and system architecture
  • Perform other responsibilities as assigned.

What Will Our Ideal Candidate Have?

  • 7+years in programming and software development.
  • Proven track record of empowering and guiding multiple teams simultaneously.
  • Tech Stack: Proficiency in Python, JavaScript, TypeScript, and React.
  • Cloud & Infrastructure: Expertise with AWS (specifically CDK), Terraform, and Jenkins.
  • Modern Tools: Strong background in API Development, GitHub, and integrating AI/GenAI solutions.
  • Delivery: Advanced delivery skills including the ability to examine and assess the effectiveness of software design strategies and methodologies across an organization, the ability to devise, apply, and share ways to ensure the quality, production readiness, and continued health of complex computer systems, the ability to incorporate awareness and understanding of work happening outside of the team, and the ability to develop widely used technical metrics that enable engineers to better understand and deliver their work.
  • Domain Expertise: Demonstrated track record of domain expertise including the ability to leverage expertise to improve company level capabilities within domain, consult on business priorities and optimize value by identifying business aligned solutions and thoughtfully and practically introduce concepts and technologies from the industry.
  • Problem Solving: Strong problem solver who creates architecture that is particularly robust against single points of failure, both in terms of systems and people and looks ahead 6-12 months to identify areas of need and turns this into action.
  • Communication: Strong communicator who possesses the ability to describe technology concepts in ways the business can understand, document effectively so that systems/architectures can be maintained or built upon, collaborate across disparate groups, helping to identify common goals and gain consensus, adapt language to meet the needs of various levels of technical and non-technical audiences and model and assist others in the practice of mindful communication, active listening, and messaging.
  • Leadership: 2+ years of technical leadership experience. Advanced leadership skills including the ability to leverage internal networks across engineering and engage with other leaders to solve problems and develop strong credibility throughout the company as well as choose the most critical engineering challenges and work to improve the entire engineering organization by teaching others and sharing knowledge while creating opportunities for others to showcase and develop skills.

What is a Must Have?

  • Bachelor’s degree in computer science, related STEM field, or its equivalent in education and/or work experience.
  • 7 additional years of software engineering experience.
  • 2 years of technical leadership experience.

What Is in It for You?

  • Health Insurance: Employees and their eligible family members – including spouses, domestic partners, and children – are eligible for coverage from the first day of employment.
  • Retirement: Travelers matches your 401(k) contributions dollar-for-dollar up to your first 5% of eligible pay, subject to an annual maximum. If you have student loan debt, you can enroll in the Paying it Forward Savings Program. When you make a payment toward your student loan, Travelers will make an annual contribution into your 401(k) account. You are also eligible for a Pension Plan that is 100% funded by Travelers.
  • Paid Time Off: Start your career at Travelers with a minimum of 20 days Paid Time Off annually, plus nine paid company Holidays.
  • Wellness Program: The Travelers wellness program is comprised of tools, discounts and resources that empower you to achieve your wellness goals and caregiving needs. In addition, our mental health program provides access to free professional counseling services, health coaching and other resources to support your daily life needs.
  • Volunteer Encouragement: We have a deep commitment to the communities we serve and encourage our employees to get involved. Travelers has a Matching Gift and Volunteer Rewards program that enables you to give back to the charity of your choice.

Employment Practices

Travelers is an equal opportunity employer. We value the unique abilities and talents each individual brings to our organization and recognize that we benefit in numerous ways from our differences. 

In accordance with local law, candidates seeking employment in Colorado are not required to disclose dates of attendance at or graduation from educational institutions.

If you are a candidate and have specific questions regarding the physical requirements of this role, please send us an email so we may assist you.

Travelers reserves the right to fill this position at a level above or below the level included in this posting.

To learn more about our comprehensive benefit programs please visit http://careers.travelers.com/life-at-travelers/benefits/.

About this role

Summary

Lead engineering teams, define solutions, ensure quality, and mentor engineers in a collaborative environment.

Job title

Circle Lead Engineer (CLE) - Personal Insurance

Experience level

7+ years

Minimum experience

7+ years exp

Industry

insurance

Location requirements

Hartford, CT - on-site, no remote work specified

Salary

$154k–$254k

Visa sponsorship

H-1B sponsor history

Management role

Yes

Skills & keywords

Required skills

pythonjavascripttypescriptreactawscdkterraformjenkinsapi developmentgitHub

Preferred skills

genAIcloud infrastructuresystem designleadership

Specializations

pythonjavascripttypescriptreactaws
Locations

Structured locations inferred from the posting.

Hartford, CT, USA

On-site City