z/OS Mainframe Storage Consultant

NTT DATA Careers

Apply to this job
London, London, City of, UK Until 8/22/2026 H-1B sponsor history First posted July 8, 2025 Last posted July 8, 2025
Job description

Req ID: 328127

 

Competitive salary | UK: Hybrid: 3 days/week on client site (London or Sheffield), 2 days/week remote 

 

At NTT DATA, we know that with the right people on board, anything is possible. The quality, integrity, and commitment of our employees are key factors in our company’s growth, market presence and our ability to help our clients stay a step ahead of the competition. By hiring the best people and helping them grow both professionally and personally, we ensure a bright future for NTT DATA and for the people who work here.

 

NTT DATA is currently looking for a z/OS Mainframe Storage Consultant on a hybrid working model (remote + on client site, either London or Sheffield) for our growing team in the UK. 

Responsibilities

  • zSeries Storage Management
  • Working and partnering with vendors (e.g. IBM, DELL, Broadcom)
  • Supporting and / or leading technical management of large infrastructure deployment projects
  • Supporting large-scale enterprise IT environment and the embedded controls within change, incident, and problem management processes
  • Working with Agile working practices and tooling

 

Key skills

  • Strong IBM zSeries Storage Management skills
  • Strong Technical Project management skills
  • Experience of working in a large enterprise
  • Experience working with Agile working practices and tooling
  • Experience and awareness of security, audit, risk and compliance within IT Enterprise environment 

 

Hardware Technical Skills

  • IBM DS8K disk hardware installation design, upgrade and support skills including DSCLI scripting and familiarity with HMC GUI
  • DELL DLm virtual tape (VTE with Data Domain) hardware installation design, upgrade and support skills with knowledge of GUI, NFS and Linux
  • Broadcom (Brocade) DCX hardware skills and FICON / FIBRE concepts and configuration. Set-up and utilising SanNav and Maps

 

Software Technical Skills

  • IBM core knowledge: z/OS, TSO, SDSF, JCL, IDCAMS, IWS
  • IBM storage knowledge: DFHSM, DFDSS, ICKDSF, DFSMS (inc OAM), TDMF, GDPS, CSM
  • Broadcom (CA): CA1, CA Vantage, CA Disk, CA Allocate, CA View, Endeavor 
  • Dino Software: T-rex, Terradon
  • Rocket: CR+
  • Interchip: RTD

 

Additional skills (optional)

  • Knowledge of zSeries Systems Programming concepts and technologies
  • Awareness of Network technologies and Dark Fibre concepts
  • Awareness of newer or emerging technologies
  • Awareness of IBM Virtual tape solutions (TS7700’s)
  • Experience of data centre migrations
  • Knowledge of: GKLM, Spectrum Control and Storage insights and API exploitation
  • Knowledge of Ansible Automation Platform (AAP), GitHub, Jenkins
  • Programming / scripting languages: Rexx, Python, YAML

 

Benefits

Our people are the most critical component of our long-term success and their health and wellbeing are our priority. You will enjoy a comprehensive, locally competitive benefits package.

 

About NTT DATA

NTT DATA is a $30 billion trusted global innovator of business and technology services. We serve 75% of the Fortune Global 100 and are committed to helping clients innovate, optimize and transform for long term success. As a Global Top Employer, we have diverse experts in more than 50 countries and a robust partner ecosystem of established and start-up companies. Our services include business and technology consulting, data and artificial intelligence, industry solutions, as well as the development, implementation and management of applications, infrastructure and connectivity. We are one of the leading providers of digital and AI infrastructure in the world. NTT DATA is a part of NTT Group, which invests over $3.6 billion each year in R&D to help organizations and society move confidently and sustainably into the digital future. Visit us at us.nttdata.com

NTT DATA endeavors to make https://us.nttdata.com accessible to any and all users. If you would like to contact us regarding the accessibility of our website or need assistance completing the application process, please contact us at https://us.nttdata.com/en/contact-usThis contact information is for accommodation requests only and cannot be used to inquire about the status of applications. NTT DATA is an equal opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status. For our EEO Policy Statement, please click here. If you'd like more information on your EEO rights under the law, please click here. For Pay Transparency information, please click here.

#LI-EMEA

About this role

Summary

Manage zSeries storage and support large infrastructure deployment projects.

Job title

z/OS Mainframe Storage Consultant

Experience level

3+ years

Industry

technology

Location requirements

London or Sheffield, hybrid remote work allowed

Salary

Competitive salary

Visa sponsorship

H-1B sponsor history

Management role

No

Skills & keywords

Required skills

IBM zSeries Storage ManagementTechnical Project managementlarge enterpriseAgilesecurityauditriskcomplianceIBM DS8KDELL DLmBrocadeFICONz/OSTSOSDSFJCLIDCAMSIWSDFHSMDFDSSICKDSFDFSMSTDMFGDPSCSMCA1CA VantageCA DiskCA AllocateCA ViewEndeavorT-rexTerradonCR+RTD

Preferred skills

zSeries Systems ProgrammingNetwork technologiesDark FibreIBM Virtual tape solutionsdata centre migrationsGKLMSpectrum ControlStorage insightsAPI exploitationAnsible Automation PlatformGitHubJenkinsRexxPythonYAML

Specializations

storage managementproject managementagilesecuritycompliance
Locations

Structured locations inferred from the posting.

London, UK

Hybrid City

Sheffield, UK

Hybrid City
Related searches