Lead Software Engineer

London Until 8/22/2026 First posted March 25, 2025 Last posted March 25, 2025
Job description
Lead Software Engineer

The Vision
The founder spent over 15 years’ in global markets, where he experienced how harmful the lack of innovation is within a particularly niche domain in FinTech that sees over $10tn being put at risk on a yearly basis.

Since inception in 2017 their team of 30 have gone on to create cutting edge software for world leading companies who’ve leveraged the tech to evolve their outdated capabilities with proprietary data extraction pipelines, ML models, advanced analytics and insights.

Following a successful fundraising round a major well renowned VC participated in, they’re scaling up their team, product suite and market coverage into the US.

Required experience/skills:
● Must have extensive experience across their tech stack: Javascript/TypeScript, Vue, AWS (Lambda), REST, GraphQL 
● Must understand modern software engineering/development practices (Agile, CI/CD, TDD, etc.)
● Ability to lead teams of cross-skilled teams
● Must be fluent in English and eligible to work in the UK

Great opportunity for you to get exposure in:
● Git flow (code reviews, rebasing, cherry-picking, etc.) 
● Build tooling configuration (Webpack, Rollup, etc.)
● Charting libraries for data visualization
● UX design as we build a best in class application

The Role
You’ll work closely with the VP of Engineering who has over 15 years experience of working for some of the UKs most reputable tech brands as Senior Eng Mgr, Director of Delivery etc. We’re looking for innovative engineers’ that want to join them on their journey, launch multiple products globally in the coming year and build a Frontend team in an entrepreneurial, high growth environment.

Location: London
Remote working: Flexible
Salary: £80-£100K
Job Type: Permanent
About this role

Summary

Lead cross-skilled teams in developing innovative software solutions.

Job title

Lead Software Engineer

Experience level

5+ years

Industry

fintech

Location requirements

Located in London, flexible remote work allowed.

Salary

£80-£100K

Management role

Yes

Skills & keywords

Required skills

javascripttypescriptvueawsrestgraphqlagileci/cdtddenglish

Preferred skills

gitwebpackrollupdata visualizationux design

Specializations

javascripttypescriptawsmlanalytics
Locations

Structured locations inferred from the posting.

London, UK

Hybrid City